Turok 2: Seeds of Evil Cheats - GameBoy Color

home | search | platforms | help | contact
 All cheats for this game by platform: GameBoy Color | Nintendo 64 | PC

Primary Collection of Cheats
All weapons
Enter "DLVTRKBWPS" as a password.

Unlimited lives
Enter "DLVTRKBLVS" as a password.

Unlimited energy
Enter "DLVTRKBNRG" as a password.

Bird mode
Enter "DLVTRKBBRD" as a password. Hold [Select] and press [A] during game play to fly.

Level select
Enter "DLVTRKBLVL" as a password. Pause game play and press [A] + [B] to advance to the next level.

Alternate end sequence
Press [Down] in level 9 when the enemy appears. After entering the tunnel, shoot the computer and destroy the incubator. An alternate ending sequence will begin.
Hints
Get powerful weapons
Enter "QVZLBVSQLV" as a password and play the game under the medium difficulty setting. Intentionally lose all lives, then re-enter the same password. Begin game play under the easy difficulty setting, then intentionally lose all lives. Begin a new game under the easy difficulty setting, then collect the light burden. Your character will now possess the particle accelerator and the chain gun. Note: Collect the pistol on level 2 to get ammunition for the chain gun.

LevelEasyMediumHard
2DVYLWKVYNLQVYLWKVYDTDLTLWKVYYC
3GRYLWKWVNRTRYLWKWVNNGNYLWKWVPP
4DRYLSRWVRYQRYLSRWVTSDNYLSRWVPT
5GVZLSRWQKZTVZLSRSQKBGLZLSRSVPW
6DVZLSVQKKQVZLBVSQRLDLZLBVSVVB
7GRZLBVSQZYTRZLBVBQKBGNZLBVBQVL
8DRZLBVSQGGQRZLBVBQKSDNZLBVBQVN
9GVYNBVBQGDTVYNBVBQRLGLYNBVBQQD
Copyright © 2002-2024 AbsolutCheats, All Rights Reserved
Privacy statement - Terms of use